Synonyms
Glia maturation factor beta, GMF-beta
Description
The glia maturation factor beta belongs to the actin-binding proteins ADF family, GMF subfamily. It contains an ADF-H domain, but the research of crystallography and NMR reveals that there are structures different between human and mouse ADF-H domain. GMF-β is involved in the differentiation, maintenance, and regeneration of the nervous system. It also inhibition of proliferation of tumor cells.
Molecular Weight
Approximately 16.6 kDa.
AA sequence
SESLVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDKRLVVLDEELEGVSPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPLGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEWLREKLGFFH
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
> 98 % by SDS-PAGE and HPLC analyses.
Endotoxin
< 1.0 EU per 1μg of the protein by the LAL method.
Formulation
Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20°C. Further dilutions should be made in appropriate buffered solutions.