Synonyms
Small-inducible Cytokine A11
Description
Eotaxin is a CC chemokine that signals through the CCR3 receptor. It is produced by IFN-γ-stimulated endothelial cells and TNF-activated monocytes. Eotaxin selectively chemoattracts eosinophils and, along with Eotaxin-2 and Eotaxin-3, plays a key role in the regulation of eosinophil recruitment in the asthmatic lung and in allergic reactions.
Molecular Weight
Approximately 8.4kDa.
AA sequence
HPGSIPTSCCFTMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTKLGKEICADPKKKWVQDATKHLDQKLQ TPKP
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
> 96% by SDS-PAGE and HPLC analyses.
Biological Activity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using purified eosinophils is in a concentration range of 0.1-1.0 μg/mL.
Endotoxin
<1 EU/μg of protein as determined by LAL method.
Formulation
Lyophilized from a 0.2 μm filtered concentrated solution in 20 mM PB, pH 7.4, 150 mM NaCl.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20°C. Further dilutions should be made in appropriate buffered solutions.